Beta Amyloid 40[Y10W]

$ 550.0

Quantity: 10 MG

In stock

Categories: ,

Description

Product name: Beta Amyloid 40[Y10W]

Catalog#: 1201004

Organism:

Synonyms: Beta-amyloid protein 40,Abeta,amyloid beta peptides,

CAS NO.:

Sequence: DAEFRHDSGWEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV

Modifications:

M.W:4352.86

M.F.:C196H296N54O57S1

Purity: 95% by HPLC

Counter ion: Trifluoacetate

Format: Lyophilized powder

Description: Beta-amyloid protein is thought to play a major role in the development of Alzheimer’s disease.

Uniprot ID:

Usage: For Scientific Research Use Only, Not for Human Use.