beta-defensin 104

$ 3,850.0

Quantity: 5 MG

In stock

Description

Product name: beta-defensin 104

Catalog#: 1302008

Organism: human

Synonyms: Beta-defensin 104,DEFB-4,BD-4,hBD-4,

CAS NO.:

Sequence: EFELDRICGYGTARCRKKCRSQEYRIGRCPNTYACCLRKWDESLLNRTKP

Modifications: disulfide(1-5,2-4,3-6)

M.W:

M.F.:

Quantity: 5mg

Purity: 95% by HPLC

Counter ion: Trifluoacetate

Format: Lyophilized powder

Description: Antibiotic resistant microorganisms, including MRSA, can be inhibited by HBD-4, which may represent an effective therapeutic agent for infections involving drug-resistant microorganisms.

Uniprot ID: Q8WTQ1

 

Usage: For Scientific Research Use Only, Not for Human Use.