β-endorphin

$ 550.0

Quantity: 10 MG

In stock

Categories: ,

Description

Product name: Beta-endorphin

Catalog#: 1265001

Organism: Human

Synonyms: Beta-Endorphin human, Beta-Endorphin, Beta-Lipotropin C-fragment, YGGFMTSEKSQTPLVTLFKNAIIKNAYKKGE,

CAS NO.: 61214-51-5

Sequence: Tyr-Gly-Gly-Phe-Met-Thr-Ser-Glu-Lys-Ser-Gln-Thr-Pro-Leu-Val-Thr-Leu-Phe-Lys-Asn-Ala-Ile-Ile-Lys-Asn-Ala-Tyr-Lys-Lys-Gly-Glu

M.W: 3465.03

M.F.: C158H251N39O46S

Purity: 95% by HPLC

Counter ion: Trifluoacetate

Format: Lyophilized powder

Description: β-Endorphin (β-END) is an endogenous opioid peptide derived from the common precursor proopiomelanocortin, together with adrenocorticotropic hormone (ACTH) and melanocyte-stimulating hormone (MSH).

Uniprot ID: P01189

 

Usage: For Scientific Research Use Only, Not for Human Use.