d-LL-37

$ 650.0

Quantity: 10 MG

In stock

Description

Product name: d-LL-37

Catalog#: 1301025

Synonyms: LL-37,Cathelicidin,hCAP-18,CAP-18,cationic antimicrobial protein,cationic antimicrobial peptide,LL 37,

CAS NO.:

Sequence: [LL-37, 37 aa]

Modifications: all d-configuration

M.W: 4493.26

M.F.: C205H340N60O53

Purity: 95% by HPLC

Counter ion: Trifluoacetate

Format: Lyophilized powder

Description: The unnatural enantiomer d-LL-37 (in which each amino acid is in the d-configuration) was found to be resistant to trypsin degradation. d-LL-37 represents a potential therapeutic candidate by being a protease-resistant peptide that is effective in inhibiting biofilm formation, increasing the rate of twitching motility, and possesses potentially wound-healing properties toward the host, illustrating its potential to be developed as topical treatments against biofilm-forming bacteria in skin wounds.

Uniprot ID: P49913

 

Usage: For Scientific Research Use Only, Not for Human Use.