$ 650.0
Quantity: 10 MG
In stock
Description
Product name: d-LL-37
Catalog#: 1301025
Synonyms: LL-37,Cathelicidin,hCAP-18,CAP-18,cationic antimicrobial protein,cationic antimicrobial peptide,LL 37,
CAS NO.:
Sequence: [LL-37, 37 aa]
Modifications: all d-configuration
M.W: 4493.26
M.F.: C205H340N60O53
Purity: 95% by HPLC
Counter ion: Trifluoacetate
Format: Lyophilized powder
Description: The unnatural enantiomer d-LL-37 (in which each amino acid is in the d-configuration) was found to be resistant to trypsin degradation. d-LL-37 represents a potential therapeutic candidate by being a protease-resistant peptide that is effective in inhibiting biofilm formation, increasing the rate of twitching motility, and possesses potentially wound-healing properties toward the host, illustrating its potential to be developed as topical treatments against biofilm-forming bacteria in skin wounds.
Uniprot ID: P49913
Usage: For Scientific Research Use Only, Not for Human Use.

