Dendroaspis natriuretic peptide

$ 980.0

Quantity: 50 MG

In stock

Description

Product name: Dendroaspis natriuretic peptide

Catalog#: 2227001

Organism: Eastern green mamba

Synonyms: DNP,

CAS NO.:

Sequence: EVKYDPCFGHKIDRINHVSNLGCPSLRDPRPNAPSTSA

Modifications: disulfide(7-23),

M.W:4190.66

M.F.:C180H286N56O56S2

Purity: 95% by HPLC

Counter ion: Trifluoacetate

Format: Lyophilized powder

Description: Dendroaspis natriuretic peptide (DNP) , which was isolated from the venom of the green mamba (Dendroaspis angusticeps), having greater potency and increased stability as compared to the mammalian family members.DNP is the most potent natriuretic peptide to cause lower esophageal sphincter relaxation, which might be mediated by natriuretic peptide receptor-A or a novel DNP-selective natriuretic peptide receptor.

Uniprot ID: P28374

 

Usage: For Scientific Research Use Only, Not for Human Use.