drosomycin

Quantity:1mg

SKU: 1325001 Category: Tags: ,

Description

Product name: drosomycin

Catalog#: 1325001

Organism: Fruit fly

Synonyms: Cysteine-rich peptide, DCLSGRYKGPCAVWDNETCRRVCKEEGRSSGHCSPSLKCWCEGC

CAS NO.:

Sequence: Asp-Cys-Leu-Ser-Gly-Arg-Tyr-Lys-Gly-Pro-Cys-Ala-Val-Trp-Asp-Asn-Glu-Thr-Cys-Arg-Arg-Val-Cys-Lys-Glu-Glu-Gly-Arg-Ser-Ser-Gly-His-Cys-Ser-Pro-Ser-Leu-Lys-Cys-Trp- Cys-Glu-Gly-Cys

Modifications: disulfide(1-8,2-5,3-6,4-7),

M.W:

M.F.:

Purity: 95% by HPLC

Counter ion: Trifluoacetate

Format: Lyophilized powder

Description: Drosomycin is a 44-residue antifungal peptide with four intramolecular disulfide bridges which have been isolated from immune-challenged Drosophila.

Uniprot ID: P41964

 

Usage: For Scientific Research Use Only, Not for Human Use.