$ 600.0
Quantity:50mg
In stock
Description
Product name: GLP-1(7-36) amide
Catalog#: 1208003
Organism: Human
Synonyms: GLP-1[7-36 amide], GLP-1(7-36),Insulinotropin (human),
CAS NO.: 107444-51-9
Sequence: HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR
Modifications: C-terminal amide,
M.F.: C149H226N40O45
M.W: 3297.63
Purity: 95%
Counter ion: Trifluoacetate
Format: Lyophilized powder
Description: -like peptide 1 (7–36) amide (GLP-1) and exendin-4 are gastrointestinal hormones as well as neuropeptides involved in glucose homeostasis and feeding regulation, both peripherally and at the central nervous system (CNS), acting through the same GLP-1 receptor. Administration of intravenous GLP-1 (7-36) amide to patients undergoing cardiac surgery significantly reduced their plasma glucose levels intraoperatively and may represent a novel therapeutic strategy to prevent perioperative hyperglycemia.
Compound ID: 16133831
Uniprot ID: P01275
Usage: For Scientific Research Use Only, Not for Human Use.
