GLP-1(7-36) amide

$600.00

Quantity:50mg

2 in stock

Description

Product name: GLP-1(7-36) amide

Catalog#: 1208003

Organism: Human

Synonyms: GLP-1[7-36 amide], GLP-1(7-36),Insulinotropin (human), Preproglucagon 78-107 Amide,

CAS NO.: 107444-51-9

Sequence: HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR

Modifications: C-terminal amide,

M.F.: C149H226N40O45

M.W: 3297.63

Purity: 95%

Counter ion: Trifluoacetate

Format: Lyophilized powder

Description: Glucagon-like peptide 1 (7–36) amide (GLP-1) and exendin-4 are gastrointestinal hormones as well as neuropeptides involved in glucose homeostasis and feeding regulation, both peripherally and at the central nervous system (CNS), acting through the same GLP-1 receptor. Administration of intravenous GLP-1 (7-36) amide to patients undergoing cardiac surgery significantly reduced their plasma glucose levels intraoperatively and may represent a novel therapeutic strategy to prevent perioperative hyperglycemia.

Compound ID: 16133831

Uniprot ID: P01275

 

Usage: For Scientific Research Use Only, Not for Human Use.

 

Reviews

There are no reviews yet.

Be the first to review “GLP-1(7-36) amide”

Your email address will not be published. Required fields are marked *