Human Urodilatin

Description

Product name: Urodilatin

Catalog#: 1229003

Organism: Human

Synonyms: ularitide,uro,ularitide,Atrial natriuretic factor prohormone (95-126), Atriopeptin (95-126),TAPRSLRRSSCFGGRMDRIGAQSGLGCNSFRY,

CAS NO.: 115966-23-9

Sequence: Thr-Ala-Pro-Arg-Ser-Leu-Arg-Arg-Ser-Ser-Cys-Phe-Gly-Gly-Arg-Met-Asp-Arg-Ile-Gly-Ala-Gln-Ser-Gly-Leu-Gly-Cys-Asn-Ser-Phe-Arg-Tyr

Modifications: disulfide(11-27),

M.W: 3505.97

M.F.: C145H234N52O44S3

Purity: 95%

Counter ion: Trifluoacetate

Format: Lyophilized powder

Description: Urodilatin is produced in humans by differential processing of pro-atrial natriuretic peptide in distal renal tubule cells. Physiologically, urodilatin appears to be the natriuretic peptide involved in sodium homeostasis. Ularitide exerts its pharmacological actions such as vasodilation, diuresis, and natriuresis through the natriuretic peptide receptor/particulate guanylate cyclase/cyclic guanosine monophosphate pathway. Urodilatin stimulates extraneuronal dopamine uptake in external renal cortex by activation of the type A natriuretic peptide receptor, coupled to cyclic guanylate monophosphate signaling and protein kinase G. Moreover, urodilatin enhances dopamine-induced inhibition of Na+, K+-ATPase activity in renal tubules.

Uniprot ID: P01160

Drug Bank ID: http://www.drugbank.ca/drugs/DB05034

 

Usage: For Scientific Research Use Only, Not for Human Use.