$ 3,000.0
Quantity: 1 MG
Available on backorder
Description
Product name: Interleukin-8,human
Catalog#: 5101002
Source: chemical synthesis
Synonyms: chemokine 8,Emoctakin,Granulocyte chemotactic Protein 1,GCP-1,Monocyte-derived neutrophil chemotactic factor,MDNCF,Monocyte-derived neutrophil-activating peptide,MONAP
Neutrophil-activating protein 1,NAP-1,Protein 3-10C,T-cell chemotactic factor,
CAS NO.:
Sequence: AVLP(Cit)SAKELRCQCIKTYSKPFHPKFIKELRVIESGPHCANTEIIVKLSDGRELCLDPKENWVQRVVEKFLKRAENS
Modifications: Cit5,disulfide(1-3,2-4),
M.W:
M.F.:
Purity: 95% by HPLC
Format: Lyophilized powder
Description: Interleukin-8 (IL-8) is a proinflammatory CXC chemokine associated with the promotion of neutrophil chemotaxis and degranulation. This chemokine activates multiple intracellular signaling pathways downstream of two cell-surface, G protein-coupled receptors (CXCR1 and CXCR2). Interleukin-8 (IL-8) has been shown to play an important role in tumor growth, angiogenesis, and metastasis, and has close relationship with oxidative stress.
Uniprot ID: P10145
Usage: For Scientific Research Use Only, Not for Human Use.
Reference:
Veterinary Immunology and Immunopathology, Volume 159, Issues 1–2, 15 May 2014, Pages 97-102.
Journal of Pediatric Surgery, Volume 49, Issue 3, March 2014, Pages 385-389.
Journal of Infection and Chemotherapy, Volume 19, Issue 5, 2013, Pages 825-832.
International Immunopharmacology, Volume 16, Issue 2, June 2013, Pages 261-267.

