- You cannot add that amount to the cart — we have 1 in stock and you already have 1 in your cart. View cart
$ 2,000.0
Quantity: 1 MG
Available on backorder
Description
Product name: Lunasin
Catalog#: 1802011
Organism: Rye
Synonyms: Plant-derived peptides, SKWQHQQDSCRKQLQGVNLTPCEKHIMEKIQGRGDDDDDDDDD,
CAS NO.:
Sequence: Ser-Lys-Trp-Gln-His-Gln-Gln-Asp-Ser-Cys-Arg-Lys-Gln-Leu-Gln-Gly-Val-Asn-Leu-Thr-Pro-Cys-Glu-Lys-His-Ile-Met-Glu-Lys-Ile-Gln-Gly-Arg-Gly-Asp-Asp-Asp-Asp-Asp-Asp-Asp-Asp-Asp
M.W: 5028.32
M.F.: C204H321N65O78S3
Purity: 95%
Counter ion: Trifluoacetate
Format: Lyophilized powder
Description: Lunasin is a novel, cancer-preventive, anti-inflammatory and cholesterol-reducing peptide that was originally isolated from soy and later from barley, wheat and rye. It comprises 43 amino acid residues and is characterised by a high content of charged amino acids (19 in total), including a continuous sequence of nine aspartate residues at the C-terminus. The effect of lunasin on chronic diseases, including cancer, cardiovascular disease, and immunological disorders, has been extensively studied. Lunasin exerts antioxidant and anti-inflammatory properties which may contribute to its chemopreventive response. The anti-inflammatory properties of lunasin were revealed by its ability to inhibit pro-inflammatory mediator secretion by lipopolysaccharide (LPS)-stimulated RAW 264.7 cells. Subsequently, the ability of lunasin to block nuclear factor (NF)-κB signaling pathways has also been demonstrated, which was found to be via downregulation of Akt phosphorylation and p65 protein expression in activated human THP-1 macrophages . These findings indicate that the anti-inflammatory properties of lunasin could contribute to its protective effects against several related disorders. Investigation into phytochemical chemoprevention capabilities is encouraged for the development of promising natural agents to prevent and/or cure cancer progression without additional side effects.
Uniprot ID: P19594
Usage: For Scientific Research Use Only, Not for Human Use.

