Murine beta-defensin 2

$ 3,850.0

Quantity: 5 MG

In stock

Description

Product name: Murine beta-defensin 2

Catalog#: 1302006

Organism: mouse

Synonyms: Beta-defensin 2,BD-2,mBD-2,Defensin, beta 2,

CAS NO.:

Sequence: AVGSLKSIGYEAELDHCHTNGGYCVRAICPPSARRPGSCFPEKNPCCKYMK

Modifications: disulfide(1-5,2-4,3-6)

M.W:

M.F.:

Quantity: 5mg

Purity: 95% by HPLC

Counter ion: Trifluoacetate

Format: Lyophilized powder

Description: Murine beta-defensin 2 (Mbd2), a small molecular weight protein expressed by epithelial cells, has been shown to enhance antigen-specific immune responses by recruiting and activating professional antigen presenting cells to the site of vaccination.

Uniprot ID: P82020

 

Usage: For Scientific Research Use Only, Not for Human Use.