Neuropeptide W-30

$550.00

Quantity: 10 MG

1 in stock

SKU: 1290005 Categories: ,

Description

Product name: Neuropeptide W-30

Catalog#: 1290005

Organism: Human

Synonyms: NPW30,hL8C,

CAS NO.:

Sequence: WYKHVASPRYHTVGRAAGLLMGLRRSPYLW

Modifications:

M.W:3543.13

M.F.:C165H249N49O37S1

Purity: 95% by HPLC

Counter ion: Trifluoacetate

Format: Lyophilized powder

Description:

Uniprot ID: Q8N729

Usage: For Scientific Research Use Only, Not for Human Use.

Reviews

There are no reviews yet.

Be the first to review “Neuropeptide W-30”

This website uses non-personal cookies to give you best relevant experience. Dismiss