Osteocrin

$1,350.00

Quantity: 10 MG

1 in stock

Categories: ,

Description

Product name: Osteocrin

Catalog#: 1293001

Organism: Human

Synonyms: Musclin

CAS NO.:

Sequence: SFSGFGSPLDRLSAGSVDHKGKQRKVVDHPKRRFGIPMDRIGRNRLSNSR

Modifications: c-terminal amide,

M.W:5621.35

M.F.:C241H397N85O69S1

Purity: 95% by HPLC

Counter ion: Trifluoacetate

Format: Lyophilized powder

Description:

Uniprot ID: P61366

Usage: For Scientific Research Use Only, Not for Human Use.

Reviews

There are no reviews yet.

Be the first to review “Osteocrin”

This website uses non-personal cookies to give you best relevant experience. Dismiss