Preptin

$ 650.0

Quantity: 10 MG

In stock

SKU: 1278002 Categories: ,

Description

Product name: Preptin

Catalog#: 1278002

Organism: Human

Synonyms:

CAS NO.:

Sequence: DVSTPPTVLPDNFPRYPVGKFFQYDTWKQSTQRL

Modifications:

M.W:4029.49

M.F.:C187H275N47O53

Purity: 95% by HPLC

Counter ion: Trifluoacetate

Format: Lyophilized powder

Description: Preptin, a 34-amino acid residue peptide hormone is co-secreted with insulin from the β-pancreatic cells and is active in fuel metabolism.

Uniprot ID: P01344

 

Usage: For Scientific Research Use Only, Not for Human Use.