$ 4,500.0
Quantity: 1 MG
Available on backorder
Description
Product name: Root cyclotide 1
Catalog#: 2202010
Organism: Australian violet
Synonyms: Vhr1,
CAS NO.:
Sequence: GIPCAESCVWIPCTVTALLGCSCSNKVCYN
Modifications: head-to-tail cyclization,disulfide(1-4,2-5,3-6),
M.W:
M.F.:
Purity: 95% by HPLC
Counter ion: Trifluoacetate
Format: Lyophilized powder
Description: Cyclotides are disulfide-rich plant proteins that are exceptional in their cyclic structure; their N and C termini are joined by a peptide bond, forming a continuous circular backbone, which is reinforced by three interlocked disulfide bonds. Cyclotides have been found mainly in the coffee (Rubiaceae) and violet (Violaceae) plant families.The insecticidal and other activities attributed to the cyclotides suggest that the physiological advantages conferred by their unique structural features make them a promising scaffold for pharmaceutical and agricultural development.
Uniprot ID: P83937
Usage: For Scientific Research Use Only, Not for Human Use.
Reference:
Current Opinion in Chemical Biology, Volume 17, Issue 4, August 2013, Pages 546-554.
Methods in Enzymology, Volume 516, 2012, Pages 37-62.
Phytochemistry, Volume 71, Issue 1, January 2010, Pages 13-20.
Gene, Volume 431, Issues 1–2, 15 February 2009, Pages 23-32.
