Tuberoinfundibular peptide

$ 850.0

Quantity: 10 MG

In stock

Description

Product name: Tuberoinfundibular peptide

Catalog#: 2215001

Organism: Human

Synonyms: TIP39,Parathyroid hormone 2

CAS NO.:

Sequence: SLALADDAAFRERARLLAALERRHWLNSYMHKLLVLDAP

Modifications:

M.W:4504.20

M.F.:C202H325N61O54S1

Purity: 95% by HPLC

Counter ion: Trifluoacetate

Format: Lyophilized powder

Description: Tuberoinfundibular peptide of 39 residues (TIP39) synthesizing neurons at the caudal border of the thalamus and in the lateral pons project to areas rich in its receptor, the parathyroid hormone 2 receptor (PTH2R).

Uniprot ID: Q96A98

 

Usage: For Scientific Research Use Only, Not for Human Use.