Urocortin-3

$ 650.0

Quantity: 10 MG

In stock

Description

Product name: Urocortin-3

Catalog#: 1201003

Organism: Human

Synonyms:

CAS NO.:

Sequence: FTLSLDVPTNIMNLLFNIAKAKNLRAQAAANAHLMAQI

Modifications: c-terminal amide,

M.W:4137.89

M.F.:C185H307N53O50S2

Purity: 95% by HPLC

Counter ion: Trifluoacetate

Format: Lyophilized powder

Description: Urocortin 3 (Ucn 3) was found to impair passive avoidance learning in male and female mice.UCN-3 regulates food intake, body temperature, and gastric emptying via the CRH-R2 in the brain of chicks.

Uniprot ID: Q969E3

 

Usage: For Scientific Research Use Only, Not for Human Use.